abstract |
An antibody specific for an epitope present on CD22 is provided. The invention relates to an antibody that specifically binds to an epitope of CD22, the amino acid sequence, EVQLVESGGGLVKPGGSLX 1 LSCAASGFAFSIYDMSWVRQAPGKGLEWVAYISSGGGTTYYPDTVKGRFTISRDNAKNX 2 LYLQMX 3 SLRAEDTAMYYCARHSGYGSSYGVLFAYWGQGTLVTVSS (X 1 is K or R, X 2 is S or T, X 3 is an N or S) antibody comprising an immunoglobulin heavy chain comprising a VH region and an immunoglobulin light chain. [Selection] Figure 2A |