| abstract |
A novel HCV vaccine is provided. A hepatitis C virus (HCV) vaccine comprising at least a plurality of epitopes, each of which is from a different hot spot epitope, wherein the hot spot epitope is KFPPGGGQIVGGVYLLLPRGPRLGVRATRK, GYKVLVLNPVSVAAT, etc. A vaccine characterized by being defined as an epitope comprising a peptide selected from the group consisting of the following specific sequences: [Selection figure] None |