http://rdf.ncbi.nlm.nih.gov/pubchem/patent/JP-2009165378-A
Outgoing Links
| Predicate | Object |
|---|---|
| assignee | http://rdf.ncbi.nlm.nih.gov/pubchem/patentassignee/MD5_82cbc291d77c061ac9a216f86ec010a3 |
| classificationIPCInventive | http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C12N15-09 http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C07K14-435 http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C12P21-02 |
| filingDate | 2008-01-15-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| inventor | http://rdf.ncbi.nlm.nih.gov/pubchem/patentinventor/MD5_5fef337f99c421c438ae84904e6e309d |
| publicationDate | 2009-07-30-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| publicationNumber | JP-2009165378-A |
| titleOfInvention | Manamako egg maturation-inducing peptide |
| abstract | [PROBLEMS] To elucidate the protein structure of a sea cucumber egg maturation-inducing hormone in order to increase the yield of mature sea cucumber eggs, and to elucidate the minimum effective protein structure with high economic efficiency. [MEANS FOR SOLVING PROBLEMS] A sea cucumber oocyte maturation-inducing active peptide having a molecular weight of 4.6 kDa (measured by TOF-MS method or acrylamide electrophoretic method) derived from a sea cucumber radiating nerve tissue, including the amino acid sequence: VLSKQAHHHHHEGWSLPGVPAEIDDLAGNIDYNIFKEQREKIK (SEQ ID NO: 1) A peptide comprising the peptide and an amino acid sequence that is a partial sequence of the peptide, and having activity of inducing ripening of sea cucumber. [Selection] Figure 10 |
| priorityDate | 2008-01-15-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| type | http://data.epo.org/linked-data/def/patent/Publication |
Incoming Links
Total number of triples: 39.