http://rdf.ncbi.nlm.nih.gov/pubchem/patent/ES-2700547-T3
Outgoing Links
| Predicate | Object |
|---|---|
| assignee | http://rdf.ncbi.nlm.nih.gov/pubchem/patentassignee/MD5_3120ae9cab5bb4831f0cc16288966367 |
| classificationCPCAdditional | http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C07K2319-00 |
| classificationCPCInventive | http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C07K14-605 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C07K14-395 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C12P21-02 |
| classificationIPCInventive | http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C12N15-00 http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C07K14-435 |
| filingDate | 2015-03-02-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| grantDate | 2019-02-18-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| inventor | http://rdf.ncbi.nlm.nih.gov/pubchem/patentinventor/MD5_920826f33a4f6cd0235f4497eeb696be |
| publicationDate | 2019-02-18-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| publicationNumber | ES-2700547-T3 |
| titleOfInvention | Variants of alpha mating factor pro-peptide |
| abstract | A method for the recombinant expression of a polypeptide comprising a GLP-1 peptide in yeast comprising the cultivation of a yeast strain comprising a DNA sequence encoding a processing and secretion signal towards the upstream end of the polypeptide, wherein said processing and secretion signal comprises a pro-peptide variant of the pairing factor α having at least one substitution in the VIGYL sequence at positions 38-42 to comprise the amino acid sequence of the general formula (I): X38-X39-X40-X41-X42 (sec. With identification number: 1) (I) where X38 is F, L or V, X39 L, I, V or M, X40 is G or R, X41 it is S, Y, L, I, V or M, and X42 is Y, W, L, V or M; or where X38 is I or V, X39 L, I, V or M, X40 is A, G, Y, F, W, R, K, L, I, V or M, X41 is Y, F, or W , and X42 is L or I; wherein said pro-peptide mating factor α is amino acid residues 20-85 in the polypeptide: MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYLDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKE EGVSLDKR (sec. of amino acids with respect to said polypeptide |
| priorityDate | 2014-02-28-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| type | http://data.epo.org/linked-data/def/patent/Publication |
Incoming Links
Total number of triples: 201.