http://rdf.ncbi.nlm.nih.gov/pubchem/patent/ES-2685605-T3
Outgoing Links
| Predicate | Object |
|---|---|
| assignee | http://rdf.ncbi.nlm.nih.gov/pubchem/patentassignee/MD5_ec0024795f45a646ef64b3664ab8a26d |
| classificationCPCAdditional | http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C12N2750-00043 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C12N2750-00022 |
| classificationCPCInventive | http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C07K14-005 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/C12Q1-701 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P37-06 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P35-00 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P35-02 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P3-10 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P25-00 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P19-02 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P17-02 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P11-06 http://rdf.ncbi.nlm.nih.gov/pubchem/patentcpc/A61P1-04 |
| classificationIPCInventive | http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C12Q1-70 http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C07K14-005 |
| filingDate | 2011-06-24-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| grantDate | 2018-10-10-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| inventor | http://rdf.ncbi.nlm.nih.gov/pubchem/patentinventor/MD5_59f9342e27532135dbd0378fca585b07 http://rdf.ncbi.nlm.nih.gov/pubchem/patentinventor/MD5_87f4d80907f7d940c7f0885dd0d0ce74 |
| publicationDate | 2018-10-10-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| publicationNumber | ES-2685605-T3 |
| titleOfInvention | Reorganized TT virus molecules for use in diagnosis, prevention and treatment of cancer and autoimmunity |
| abstract | A rearranged TT virus poly (nucleic acid comprising A) a nucleotide sequence that shows at least 70% identity with respect to a nucleotide sequence that is selected from the nucleotide sequences shown in Figure 6 and a poly ( nucleic acid) encoding a polypeptide containing a signature motif of a mammalian protein that is associated with cancer or an autoimmune disease, in which the rearranged TT virus poly (nucleic acid) is selected from the group of μVTT molecules consisting of zpr4.20 shown in figure 11B, zpr9.6 shown in figure 12B and zpr12.24 shown in figure 13B; or B) (a) a nucleotide sequence that is selected from the nucleotide sequences shown in Figure 6; (b) a nucleotide sequence that shows at least 70% identity with respect to a nucleotide sequence of (a) and said rearranged TT virus poly (nucleic acid) is capable of replicating autonomously after transfecting it in 293TT cells; (c) a nucleotide sequence that is the complement of the nucleotide sequence of (a) or (b); or (d) a nucleotide sequence encoding an amino acid sequence selected from the amino acid sequences RVPKVSLHTA VKGQFGLGTG RAM, RVPKVSLHTA VKGQFGLGTG RAM, RVPEVSLHTA VKGQFGLGTG RAM, GAEGEFTHRS QGAIRARDWP GHG GAEGEFTHRS QGAIRARDWP GYG, GAVGEFTHRS QGAIRARDWP GYG and GAGGEFTHRS QGAIRARDWP GYG shown in Figure 14 and said reorganized TT virus poly (nucleic acid) is capable of replicating autonomously after transfection into 293TT cells, wherein said nucleotide sequence of (a), (b), (c) or (d) is linked to a poly (nucleic acid) encoding a polypeptide that contains a signature motif of a mammalian protein that is associated with cancer or an autoimmune disease via a phosphodiester bond, the signature motif is at least 10 aa and the degree of identity of this signature motive with respect to a corresponding motif in a mammalian protein is at least 80%, but it is not identical to that motive. ndiente, wherein said corresponding motif is selected from the group consisting of (1) opsin selected from the amino acid sequences IYNSFHRGFALG and RLELQKRLPW LELNEKAVE; (2) protamine 1 selected from the amino acid sequences ARYRRRSRSRSRSRYGRRRRRSRSRRRRSRRRRR, ARYRCCRSKSRSRCRRRRRRCRRRRRRCCRRRRR, and ARYRCCRSPSRSRCRRRRRRFYRRRRRCHRRRRR; (3) protamine 2 selected from the amino acid sequences HTRRRRSCRRRRRRACRHRRHRRGCRRIRRRRCR, RRRSRSCRRRRRRSCRYRRRPRRGCRSRRRRRCRR, HRRRRSCRRRRRHSCRHRRRHRRGCRRSRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRCR (4) galanin having the amino acid sequences of ATLGLGSPVKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELEPEDEARPGSFDRPL SESNIVRTIIEFLSFLHLKEAGALDRLPGLPAAASSEDLERS; (5) plexin / semaforin / integrin repeat signature having the amino acid sequences of RCSQVGVTSCSECLLARDPVGCGWCSSEGRCTRGERCDERRGSRQNWSSGPSSQCQ (6) gastrin having the amino acid sequence of VAGEDSDGCYVQLPRSR; (7) collagenase having the amino acid sequence of MSRLAELYLLGDSIKGRHDNLWLAAAEMLSYYAPEGKSELGIDICQAKLELAAKV1PYLYEC SGPAAIRSQDLTDGQAASACDILRNKEKDFHQVKYTGKTPVADDGNTRVEVGVFVSEEDYKR YSAFASKEVKAQFGRVTDNGGMYLEGNPSDAGNQVRFIAYEEAKLNADLSIGNLEHEYTHYL DGRFDTYGTFSRNLEESHIVWWEEGFAEYVHYKQGGVPYQAAPELIGQGSKLYLSDVFTTTE EGYAELFAGSHDTDRIYRWGYLAVRFMLETNHNRDYESLLYHSRYGNSFAFYAYLVKLLGYM YNNEFGIWNNEFGIW; (8) Collagen helix repeat having the amino acid sequence of GPPGPPGPPGPPGPPGPPGPPGPAGAPGPPGPPGEPGPPGPPGPPGPPGPPGAPGAPGP; (9) sperm-specific male protein having the amino acid sequence of VGGPCGPCGPCGGPCCGSCCSPCGGPCGPCGPCGPCGPCCGGCGPC GPCGPCCGTTEKYCGL; (10) microbial collagenase metalloprotease (M9) signature that has the amino acid sequence of GLETLVEFLRAGYYVRFYN; (11) Micronema MIC1 protein signature that has the amino acid sequence of TYISTKLDVAVGSCHK; (12) autoimmune regulator (AIRE) firm that has the amino acid sequence of DFWRVLFKDYNLERY; (13) gliadin having the amino acid sequence of PQAQGSVQPQQLPQFEEIRNL; (14) neuropeptide Y2 receptor signature that has the AFLSAFRCEQRLDAIHS sequence; (15) aerolysin having the amino acid sequence of WDKRYIPGEVKWWDWNWTIQ; (16) orexin that has the amino acid sequence of MNLPSAKVSWAAYTLLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSC RLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQASGNHAAGILT MGRRAGAELEPRLCPGRRCLAGRARASAPRAPRCLAGRAVASPGRRCLAGRADRVAPAPRCLAGRAPRAPAPRCLAGRASPALP (17) GIP receptor having the amino acid sequence of PRLGPYlGDQTLTLWNQALAA; (18) prion having the amino acid sequence of SNGGSRYPGQGSPGGNRYPPQ; (19) neurotensin having the amino acid sequence of METSSPWPPRPSP; (20) signature of the orphan nuclear receptor family (A4 nuclear receptor) that has the amino acid sequence of PVNLLNALVRAHVDSTP; (21) brain-derived neurotrophic factor (BDN) signature that has the amino acid sequence of PLLFLLEEYKNYLDAAN; (22) calcitonin having the amino acid sequence of KCYDRMQQLPPYEGEGPY; (23) type I leukotriene B4 receptor selected from the amino acid sequences SRRLRVRRFHRRRRTGR and GRRLQARRFRRSRRTGR; (24) Sjögren syndrome / scleroderma autoantigen 1 (p27 autoantigen) having the amino acid sequence of EISKKMAELLLKGATMLDEHCPKCGTPLFRLKDGKVFCPICE; (25) vasopressin having the amino acid sequence of RAGGRRRGRRTGSPSEGARV; (26) melanin concentrating hormone receptor 2 signature that has the amino acid sequence of LVQPFRLTRWRTRYKTIRIN; (27) prostanoid EP1 receptor signature that has the amino acid sequence of ISLGPPGGWRQALLAGL; (28) cyclininase having the amino acid sequence of EWRSLGVQQSLGWVH; (29) peroxisome proliferator activated receptor signature (nuclear 1C receptor) having the amino acid sequence of KTETDASLHPLLQ; (30) M1 muscarinic receptor signature that has the amino acid sequence of KMPMVDPEAQAPTKQPPK; (31) Type B2 receptor of metabotropic gamma-aminobutyric acid (GABA) having the amino acid sequence of LAPGAWGWARGAPRPPPSS; (32) arginine deaminase signature having the amino acid sequence of SELSRGRGGPRCMSMPLVR; (33) repetition of opioid growth factor having the amino acid sequence of SPSETPGPRPAGPARDEPAE; (34) CD36 adhesion molecule signature having the amino acid sequence of WIFDVQNPDEVAKNSSKIKVKQR; (35) myelin protein protelipidic protein (PLP) signature that has the amino acid sequence of GVVLGAIIGGVLGVVLLLVLLLYLV; and (36) chlamidiaom which has the amino acid sequence of CGSYVPSCSKPCG. |
| priorityDate | 2010-06-23-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| type | http://data.epo.org/linked-data/def/patent/Publication |
Incoming Links
Total number of triples: 1461.