| abstract |
Isolated, preferably recombinant, polypeptides (I) containing the amino acid sequence for human procalcitonin (hpCT), are new. Isolated, preferably recombinant, polypeptides (I) containing the amino acid sequence for human procalcitonin (hpCT), are new, where hpCT has the sequence: APFRSALESSPADPATLSEDEARL(L/R)LAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTC MLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN Independent claims are also included for the following: (1) recombinant production of hpCT; (2) a plasmid containing at least one nucleic acid (II) encoding (I); (3) an animal, plant, isolated human or prokaryotic cell that expresses (I); (4) a sterile injectable solution containing (I); (5) preparation of antibodies (Ab) by immunization with (I); (6) a test kit containing at least one (I); (7) a control and/or standard solution containing at least one (I); and (8) a solution containing at least one (I) and at least one sterol ester of formula (II). R1OCO-R2-COO(CH2CH2)n-CH2CH2-OH R1 = sterol; n = 1-200; and R2 = 4-8C aliphatic or aromatic ring, optionally with at least one atom replaced by nitrogen, sulfur or oxygen, or a 0-12C linear or branched chain. |