http://rdf.ncbi.nlm.nih.gov/pubchem/patent/CN-109942710-B
Outgoing Links
| Predicate | Object |
|---|---|
| classificationIPCInventive | http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/G01N33-577 http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/C07K16-44 http://rdf.ncbi.nlm.nih.gov/pubchem/patentipc/G01N33-558 |
| filingDate | 2018-12-25-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| grantDate | 2021-06-18-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| publicationDate | 2021-06-18-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| publicationNumber | CN-109942710-B |
| titleOfInvention | Biphenthrin monoclonal antibody and preparation method and application thereof |
| abstract | The invention relates to a bifenthrin monoclonal antibody, which is characterized in that: comprises a heavy chain variable region and a light chain variable region, wherein the amino acid sequence of the heavy chain variable region is as follows: QVKLQQSGPGLVAPSQLQVSACTVSGLRSLSGVSWVRQPPGKLESWLGVIWSGRTNYHSALISRLTISKDNSKSQVFLNLNSLQIDDSATYYCVQRARLRWGVYNMDYWSQGTTVTVSS, respectively; the amino acid sequence of the light chain variable region is as follows: DIELTQSPSSMYASLGERVTLTCKASQGINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGGSFGQDFSLTISSLEYEDLGIYYCLQYDEFPWTFGGGTKLEIKR, respectively; compared with the prior art, the invention has the advantages that: 1) the hapten is novel; 2) the antibody performance is outstanding; 3) the test strip is specific, sensitive, simple, convenient and quick; 4) the result is displayed vividly, visually and accurately; 5) saving cost, wide application range and convenient popularization. |
| priorityDate | 2018-12-25-04:00^^<http://www.w3.org/2001/XMLSchema#date> |
| type | http://data.epo.org/linked-data/def/patent/Publication |
Incoming Links
Total number of triples: 176.